- Published at
- by gurufocus.com
positive
positive
BioLineRx Issues Letter to Shareholders
PR NewswireTEL AVIV, Israel, Jan. 21, 2025
- Company outlines strategic long-term vision and financial outlook - TEL AVIV, Israel, Jan. 21, 2025 /PRNewswir
News for BioLineRx Ltd. (BLRX)
- Published at
- by investing.com
positivepositiveBioLineRx announces strategic shift with licensing deals By Investing.com
BioLineRx announces strategic shift with licensing deals- Published at
- by benzinga.com
mixedmixedNasdaq Surges Over 300 Points; State Street Earnings Top Views - JB Hunt Transport Servs (NASDAQ:JBHT), BioLine Rx (NASDAQ:BLRX)
U.S. stocks traded higher toward the end of trading, with the S&P 500 gaining around 1% on Friday. The Dow traded up 0.99% to 43,580.17 while the NASDAQ rose 1...- Published at
- by benzinga.com
positivepositiveS&P 500 Gains 1%; Fastenal Posts Downbeat Earnings - Fastenal (NASDAQ:FAST), BioLine Rx (NASDAQ:BLRX)
U.S. stocks traded higher midway through trading, with the S&P 500 gaining around 1% on Friday. The Dow traded up 0.86% to 43,524.83 while the NASDAQ rose 1.46...- Published at
- by benzinga.com
positivepositiveDow Jumps Over 300 Points; US Industrial Production Beats Estimates - AEON Biopharma (AMEX:AEON), BioLine Rx (NASDAQ:BLRX)
U.S. stocks traded higher this morning, with the Dow Jones index gaining over 300 points on Friday. Following the market opening Friday, the Dow traded up 0.76...- Published at
- by investing.com
mixedmixedBioLineRx Announces Change to Ratio of American Depositary Shares to Ordinary Shares By Investing.com
BioLineRx Announces Change to Ratio of American Depositary Shares to Ordinary Shares- Published at
- by benzinga.com
mixedmixedWhy Taiwan Semiconductor Shares Are Trading Higher By Around 5%; Here Are 20 Stocks Moving Premarket - ANI Pharmaceuticals (NASDAQ:ANIP), AEON Biopharma (AMEX:AEON)
Shares of Taiwan Semiconductor Manufacturing Company Limited TSM rose sharply in today's pre-market trading after the company announced fourth-quarter results. ...- Published at
- by benzinga.com
mixedmixedNasdaq Surges Over 200 Points; BioLineRx Shares Plummet - Blue Hat Interactive (NASDAQ:BHAT), AEON Biopharma (AMEX:AEON)
U.S. stocks traded higher toward the end of trading, with the Nasdaq Composite jumping more than 200 points on Monday. The Dow traded up 0.08% to 42,765.84 whi...- Published at
- by benzinga.com
mixedmixedS&P Jumps 1%; Regional Health Properties Shares Spike Higher - Blue Hat Interactive (NASDAQ:BHAT), AEON Biopharma (AMEX:AEON)
U.S. stocks traded higher midway through trading, with the S&P 500 jumping more than 1% on Monday. The Dow traded up 0.51% to 42,949.22 while the NASDAQ gained...- Published at
- by benzinga.com
mixedmixedUS Stocks Open Higher; Dow Jumps Over 200 Points - Blue Hat Interactive (NASDAQ:BHAT), AEON Biopharma (AMEX:AEON)
U.S. stocks traded higher this morning, with the Dow Jones index surging more than 200 points on Monday. Following the market opening Monday, the Dow traded up...- Published at
- by investing.com
mixedmixedBioLineRx Reports Third Quarter 2024 Financial Results and Provides Update on Transformation to Drive Shareholder Value By Investing.com
BioLineRx Reports Third Quarter 2024 Financial Results and Provides Update on Transformation to Drive Shareholder Value- Published at
- by investing.com
mixedmixed- Published at
- by gurufocus.com
mixedmixedBioLineRx and Ayrmid Ltd. Enter into Exclusive License Agreement to Commercialize APHEXDA® (motixafortide) through Gamida Cell Ltd.
PR NewswireTEL AVIV, Israel, Nov. 21, 2024 ”“ BioLineRx to receive $10 million upfront payment from Ayrmid Ltd. (parent company of Gamida Cell) plus up to- Published at
- by benzinga.com
mixedmixedWhy Arcadium Lithium Shares Are Trading Higher By 28%; Here Are 20 Stocks Moving Premarket - Beneficient (NASDAQ:BENF), Arcadium Lithium (NYSE:ALTM)
Shares of Arcadium Lithium plc ALTM rose sharply in today's pre-market trading after the company confirmed non-binding acquisition approach by Rio Tinto. Arcad...- Published at
- by globenewswire.com
mixedmixedIron Deficiency Anemia Market Size and Share to Grow by 2032, Predicts DelveInsight | Leading Companies Developing Therapies - Pharmacosmos, AMAG, Shield, Akebia, Keros, Keryx Biopharmaceuticals, Sier
The dynamics of the iron deficiency anemia market are anticipated to change in the coming years owing to the improvement in the research and development...- Published at
- by prnewswire.com
mixedmixedSickle Cell Disease Clinical Trial Pipeline Accelerates as 40+ Pharma Companies Rigorously Developing Drugs for the Market Entry
/PRNewswire/ -- DelveInsight's 'Sickle Cell Disease Competitive Landscape – 2023' report provides comprehensive global coverage of available, marketed, and...- Published at
- by globenewswire.com
mixedmixedDEADLINE ALERT for GOTU, AVAYAQ, BLRX, and ENVX: The Law Offices of Frank R. Cruz Reminds Investors of Class Actions on Behalf of Shareholders
LOS ANGELES, Feb. 27, 2023 (GLOBE NEWSWIRE) -- The Law Offices of Frank R. Cruz reminds investors that class action lawsuits have been filed on behalf of...- Published at
- by prnewswire.com
mixedmixedPropulsion of Pancreatic Cancer Pipeline as Novel and Extensive 170+ Therapies Likely to Enter in the Treatment Domain | DelveInsight
/PRNewswire/ -- DelveInsight's 'Pancreatic Cancer Pipeline Insight – 2022' report provides comprehensive global coverage of available, marketed, and pipeline...- Published at
- by globenewswire.com
mixedmixedNew Therapeutics Options in Pancreatic Ductal Adenocarcinoma Pipeline as 40+ Key Companies are Working on Drug Profiles | DelveInsight
DelveInsight’s pancreatic ductal adenocarcinoma pipeline report depicts a robust space with 40+ active players working to develop 50+ pipeline therapies...- Published at
- by etfdailynews.com
mixedmixedInvestment Analysts’ Upgrades for May 7th (BLRX, CDZI, CTO, DMLP, GABC, HA, HIFS, HSY, KMT, KZIA)
Read Investment Analysts’ Upgrades for May 7th (BLRX, CDZI, CTO, DMLP, GABC, HA, HIFS, HSY, KMT, KZIA) at ETF Daily NewsWYNMYWYNMFWITN.MXWITWIPRO.NSWIPRO.BOVVNTVRNAVECTUSXUSPHUBATGLSSRZNSLQTSITEREXRRDWPRVBNEXA.TONEXALVS.MXLVS.BALVSLV2B.DELEVI.MXLEVILCR.DEL1VS34.SACDZIBLRX.TABLRX1128.HK0QY4.LVITLUMHUFABTWITOMZTCPCTASEKEYSEKEFSCHYYSCHYFRWNFFRWEOYRWEN.MXRWEA.DERWE.PRRWE.MIRWE.DERNSDFRNO.PARNO.MIRNLSYRNL.DERCKYOGN.MXOGN-WINEUMNKDMECMATXLSEAWLSEALSCCLFSYYLFSYFKZIAKZA.AXHJLIWHJLIHJLBWHIFSGNPK-WTGNPK-UNGNPKGLEO-UNGLEOGABCCHFW-WTCHFW-UNCHFW6724.T1928.HK1212.HKPRTSKMT