Published at Aug 7, 2024 3:55 PM by investing.com positive positive Earnings call: Alight Solutions focuses on ARR after strategic moves By Investing.com Earnings call: Alight Solutions focuses on ARR after strategic moves WPF-WTWPF-UNWPFWDAYWGESBACALIT Read more →
Published at Feb 27, 2024 10:18 PM by marketscreener.com mixed mixed Cannae Holdings, Inc. Expands Board of Directors ~ Doug Ammerman named to fill new Board seat ~ ... WPF-WTWPF-UNWPFCNNESTN.TOSTNFNF Read more →
Published at Feb 22, 2024 1:47 AM by investing.com positive positive Earnings call: Alight reports strong financials, $3B revenue backlog By Investing.com Earnings call: Alight reports strong financials, $3B revenue backlog WPF-WTWPF-UNWPFWDAYORCLNOWMSFT.MIMSFTGESBACALIT Read more →
Published at Jun 7, 2023 11:30 PM by insidermonkey.com mixed mixed Analysts Are Cutting Price Targets of These 10 Stocks In this article, we will discuss the 10 stocks whose price targets were recently trimmed by analysts. ZMD.BAZM.MXZM.BAZMZ1OM34.SAWLTWW1LT34.SAPSFE-WTPSFEOVV.TOOVV.MXOVVEVRBABAN.MXBABAFBABA.BABABAAONAHLA.DE9988.HK0Y4Q.L0A1O.LENPH.MXENPHAUD.DEADSK.MXADSKA1UT34.SA0QYE.L0HJF.LWPF-WTWPF-UNWPFTRVC.DEC.MXC.BACBFT-UNBFT Read more →
Published at May 11, 2022 2:21 PM by investing.com mixed mixed Special Report-How Wall Street banks made a killing on SPAC craze By Reuters Special Report-How Wall Street banks made a killing on SPAC craze SPRQ-WTSPRQ-UNSPRQSPCESFTPSFE-WTPSFEMYPSDKNGACAMUACACWACACUACACLOTZWLOTZJPMWPF-WTWPF-UNWPFCBFT-UNBFT Read more →
Published at Apr 22, 2022 12:24 PM by etfdailynews.com mixed mixed Paysafe (NYSE:PSFE) Lowered to “Sell” at Zacks Investment Research Read Paysafe (NYSE:PSFE) Lowered to “Sell” at Zacks Investment Research at ETF Daily News PSFE-WTPSFEBACWPF-WTWPF-UNWPFRYCSBFT-UNBFT Read more →
Published at Apr 21, 2022 7:58 PM by etfdailynews.com mixed mixed Weekly Research Analysts’ Ratings Updates for Paysafe (PSFE) Read Weekly Research Analysts’ Ratings Updates for Paysafe (PSFE) at ETF Daily News STTRYBLQA.DEBLK.MXBLK0QZZ.L0QKU.LPSFE-WTPSFECSN.MXCSGNE.SWCSGN.SWCSGKFCSBAC0I4P.LWPF-WTWPF-UNWPFBFT-UNBFT Read more →
Published at Mar 2, 2022 5:48 PM by etfdailynews.com positive positive Austerlitz Acquisition Co. I (NYSE:AUS) Sees Large Decrease in Short Interest Read Austerlitz Acquisition Co. I (NYSE:AUS) Sees Large Decrease in Short Interest at ETF Daily News WPF-WTWPF-UNWPFSTTAUS-UNAUS Read more →
Published at Feb 23, 2022 12:31 PM by marketscreener.com positive positive Alight Reports Fourth Quarter and Full Year 2021 Results – Achieved 6.9% full year revenue growth beating initial 1% outlook – – Full year BPaaS bookings grew 52.4% to $602 million well ahead of original target of $395 million... | February 23, 2022 WPF-WTWPF-UNWPFSPGICNNEALIT Read more →
Published at Feb 8, 2022 10:52 PM by globenewswire.com mixed mixed FILING DEADLINE TODAY: Pomerantz Law Firm Investigates Claims On Behalf of Investors of Paysafe Limited f/k/a Foley Trasimene Acquisition Corp. II - PSFE NEW YORK, Feb. 08, 2022 (GLOBE NEWSWIRE) -- Pomerantz LLP is investigating claims on behalf of investors of Paysafe Limited f/k/a Foley Trasimene... PSFE-WTPSFEBFT-UNBFTWPF-WTWPF-UNWPF Read more →
Published at Dec 7, 2021 10:05 PM by globenewswire.com mixed mixed System1 Announces its Slate of Director Nominees for Election to its Board of Directors Ahead of Business Combination with Trebia Acquisition Corp LOS ANGELES, Dec. 07, 2021 (GLOBE NEWSWIRE) -- System1, an omnichannel customer acquisition platform, and Trebia Acquisition Corp. (“TREB” or “Trebia”)... TREB-WTTREB-UNTREBBKIAUS-UNAUSVSSYWVS.CNVSVRSSFTWNI-UNTWNITRUESRTPSFE-WTPSFENCRLEAFFNFDMDDHR.MXDHRDHER34.SADAP.DE0R2B.L0K45.LWPF-WTWPF-UNWPFBFT-UNBFT Read more →
Published at Jun 28, 2021 4:03 PM by marketscreener.com mixed mixed Alight highlights world-class board of directors for post-merger public company - William P. Foley, II to become chairman - - Additional directors bring broad industry, domain and product expertise - ... WPF-WTWPF-UNWPFPFGZGY.DEWRKUSY1.DEUSY.LUISTTECPSFE-WTPSFEORCLITHTAGNE.PAGEC.LGEC.DEGE.SWGE.SNGE.MXGEG1AR34.SAFNFFIS.MXFISF1NI34.SABSFBKIBFT-UNBFT0ITV.L0ILW.LCNNE Read more →